PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma99g00590.1
Common NameZOSMA_99G00590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 628aa    MW: 68700.7 Da    PI: 7.4863
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma99g00590.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.98.3e-094604922254
                      SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      ++yp+ +++  L++++gL+ +qV++WF N R +
  Zosma99g00590.1 460 HPYPTDTDKMMLSTQTGLSRNQVSNWFINARVR 492
                      89*****************************87 PP

2BELL64.62.1e-21305373472
             BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       l++kkakLl ++ eV k  k+y++q+q+ issF+ v gl +a p+ +   k i+rhFr L+  i++q+
  Zosma99g00590.1 305 RLREKKAKLLLMQSEVSKSLKHYNQQIQMAISSFKSVGGLSEAMPFLKTSVKSITRHFRFLRAVISDQL 373
                      5789**************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.3E-21239371IPR006563POX domain
PfamPF075268.5E-23244370IPR006563POX domain
PROSITE profilePS5007111.159433496IPR001356Homeobox domain
SMARTSM003893.9E-8436500IPR001356Homeobox domain
CDDcd000869.15E-11436497No hitNo description
Gene3DG3DSA:1.10.10.601.9E-26439500IPR009057Homeodomain-like
SuperFamilySSF466893.51E-16439501IPR009057Homeodomain-like
PfamPF059201.2E-17453492IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 628 aa     Download sequence    Send to blast
MNHFSCETHV AQKSRRNKLR GNGTAQSDFH RRPSTHVQLM SGDVVVDPNM FSSYQHHLLH  60
DLHQNPSLQS PGDLFMAAGQ NRQNFNSWKR LLSSSSSHSP NSDWAVNCDN DRISDSSSNH  120
GFLSASVIPP PPSLPFGSPQ PNIPTAVPWL FDGSHEYNTN GSTGLALLPA TNLSPPRNNN  180
GTPVWLPTDI TTHHDRSSST TQNRLSLTLS SNPTQPSLPV QPHSSSDILR GAGPLGPFTG  240
YATILKSSKY LKPAQILLDE YCGGVIAGSF PTNSLSSLSS KSSANHDGTD NGNDIGIGIG  300
ACHSRLREKK AKLLLMQSEV SKSLKHYNQQ IQMAISSFKS VGGLSEAMPF LKTSVKSITR  360
HFRFLRAVIS DQLLIVSKSL SEEEVRSVDH VESSEMKFLD QALLRQSTEE SSALGGFIKN  420
HGRNHNHRHD RNQPVWKPQR GLPERAVAVL RAWLFDHFLH PYPTDTDKMM LSTQTGLSRN  480
QVSNWFINAR VRVWKPMVEE IHTLDTKGLA KMDLNSSTNT DIQHNNLGEV QSDVLESAVA  540
GAGTTGNMEH WGVVPDQNKR ARIGVDSGEL TTVFSGYPCG DGGGGGFDMG ELGLVSLTLG  600
LRQEEVGQCD EQMSAYFGTQ LVREYVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B4e-15442499158Homeobox protein Meis1
4xrs_A4e-15442499158Homeobox protein Meis1
5bng_A4e-15442500159Homeobox protein Meis2
5bng_B4e-15442500159Homeobox protein Meis2
4xrm_B4e-15442500563Homeobox protein Meis2
4xrm_A4e-15442500563Homeobox protein Meis2
3k2a_B5e-15442500563Homeobox protein Meis2
3k2a_A5e-15442500563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008787382.11e-103PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_008787381.11e-103PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_008787379.11e-103PREDICTED: BEL1-like homeodomain protein 9
TrEMBLA0A0K9NHP40.0A0A0K9NHP4_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16049811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.12e-70BEL1-like homeodomain 8